General Information

  • ID:  hor005645
  • Uniprot ID:  B3EWG0
  • Protein name:  Red pigment-concentrating hormone
  • Gene name:  NA
  • Organism:  Penaeus monodon (Giant tiger prawn)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  Temporarily up-regulated under high salt conditions. |Expression changes during the molting cycle with highest expression in the late pre-molt and post-molt stages, intermediate expression in the intermolt stage and lowest expression in the early pre-molt
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031409 pigment binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLNFSPGW
  • Length:  8(22-29)
  • Propeptide:  MVRAVVATLLVVLVVASCVSAQLNFSPGWGKRAAAGGEGTGMHPPAGAVVPPPSSLAGESCGTIPVTTVMHIYRLIRAEATRLVQCQDEEYLG
  • Signal peptide:  MVRAVVATLLVVLVVASCVSA
  • Modification:  T1 Pyrrolidone carboxylic acid;T8 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone adapts the animal to light backgrounds by stimulating concentration of the pigment of its red body-chromatophores.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B3EWG0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005645_AF2.pdbhor005645_ESM.pdb

Physical Information

Mass: 107308 Formula: C45H61N11O12
Absent amino acids: ACDEHIKMRTVY Common amino acids: FGLNPQSW
pI: 6.11 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -51.25 Boman Index: -441
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 48.75
Instability Index: 6031.25 Extinction Coefficient cystines: 5500
Absorbance 280nm: 785.71

Literature

  • PubMed ID:  24937259
  • Title:  Molecular characterization of a cDNA encoding red pigment-concentrating hormone in black tiger shrimp Penaeus monodon: Implication of its function in molt and osmoregulation.
  • PubMed ID:  
  • Title:  Identification of Red pigment Concentrating Hormone in CNS of Penaeus monodon.